Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LY6G6D. Target Synonyms: Megakaryocyte-enhanced gene transcript 1 protein. Accession Number: O95868. Expression Region: 10~104aa. Tag Info: N-Terminal 10Xhis-B2M-Jd-Tagged. Theoretical MW: 15.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial is a purified Recombinant Protein.

Accession Number

O95868

Expression Region

10~104aa

Host

E. coli

Target

LY6G6D

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-B2M-Jd-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Megakaryocyte-enhanced gene transcript 1 protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toll Like Receptor 5 (TLR5) Polyclonal Antibody
CAU24897-01 100 µL

Toll Like Receptor 5 (TLR5) Polyclonal Antibody

Sign In for Pricing
View Details
Toll Like Receptor 5 (TLR5) Polyclonal Antibody
CAU24897-02 200 µL

Toll Like Receptor 5 (TLR5) Polyclonal Antibody

Sign In for Pricing
View Details
Toll Like Receptor 5 (TLR5) Polyclonal Antibody
CAU24897-03 1 mL

Toll Like Receptor 5 (TLR5) Polyclonal Antibody

Sign In for Pricing
View Details
Magnetic Stirrer (BER-4001)
BER-4001 1 Unit

Magnetic Stirrer (BER-4001)

Sign In for Pricing
View Details
FAR1 Lentiviral Activation Particles (m2)
sc-426550-LAC-2 200 µL

FAR1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Major prion protein
AP86920 1 mg

Major prion protein

Sign In for Pricing
View Details