Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ketohexokinase (KHK)

Recombinant Human Ketohexokinase (KHK) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: KHK. Target Synonyms: Hepatic fructokinase. Accession Number: P50053. Expression Region: 1~298aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 59.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ketohexokinase (KHK) is a purified Recombinant Protein.

Accession Number

P50053

Expression Region

1~298aa

Host

E. coli

Target

KHK

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

59.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatic fructokinase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF306 (Zinc Finger Protein 306, ZFP306, Zinc Finger Protein with KRAB and SCAN Domains 3, ZKSCAN3, Zinc Finger and SCAN Domain-containing Protein 13, ZSCAN13, Zinc Finger Protein 309, ZNF309, Zinc Finger Protein 47 Homolog, ZFP47, Zf47, Zfp47, Zfp-47, ZS
MBS6155877-01 0.1 mL

ZNF306 (Zinc Finger Protein 306, ZFP306, Zinc Finger Protein with KRAB and SCAN Domains 3, ZKSCAN3, Zinc Finger and SCAN Domain-containing Protein 13, ZSCAN13, Zinc Finger Protein 309, ZNF309, Zinc Finger Protein 47 Homolog, ZFP47, Zf47, Zfp47, Zfp-47, ZS

Ask
View Details
ZNF306 (Zinc Finger Protein 306, ZFP306, Zinc Finger Protein with KRAB and SCAN Domains 3, ZKSCAN3, Zinc Finger and SCAN Domain-containing Protein 13, ZSCAN13, Zinc Finger Protein 309, ZNF309, Zinc Finger Protein 47 Homolog, ZFP47, Zf47, Zfp47, Zfp-47, ZS
MBS6155877-02 5x 0.1 mL

ZNF306 (Zinc Finger Protein 306, ZFP306, Zinc Finger Protein with KRAB and SCAN Domains 3, ZKSCAN3, Zinc Finger and SCAN Domain-containing Protein 13, ZSCAN13, Zinc Finger Protein 309, ZNF309, Zinc Finger Protein 47 Homolog, ZFP47, Zf47, Zfp47, Zfp-47, ZS

Ask
View Details
TBX20 Peptide - N-terminal region
MBS3226393-01 0.1 mg

TBX20 Peptide - N-terminal region

Ask
View Details
TBX20 Peptide - N-terminal region
MBS3226393-02 5x 0.1 mg

TBX20 Peptide - N-terminal region

Ask
View Details
Pig free thyroxine (FT4) ELISA kit
MBS9424722-01 96 Tests

Pig free thyroxine (FT4) ELISA kit

Ask
View Details
Pig free thyroxine (FT4) ELISA kit
MBS9424722-02 5x 96 Tests

Pig free thyroxine (FT4) ELISA kit

Ask
View Details