Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial

Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Jak1. Target Synonyms: Janus kinase 1JAK-1. Accession Number: P52332. Expression Region: 848~1152aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial is a purified Recombinant Protein.

Accession Number

P52332

Expression Region

848~1152aa

Host

E. coli

Target

Jak1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Janus kinase 1JAK-1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVKTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF568 conjugate, 0.1mg/mL
BNC682153-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-100 1x 100 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF568 conjugate, 0.1mg/mL
BNC682564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details