Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Integrin beta-8 (ITGB8), partial

Recombinant Rabbit Integrin beta-8 (ITGB8), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: ITGB8. Target Synonyms: ITGB8Integrin beta-8. Accession Number: P26013. Expression Region: 146~384aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rabbit Integrin beta-8 (ITGB8), partial is a purified Recombinant Protein.

Accession Number

P26013

Expression Region

146~384aa

Host

E. coli

Target

ITGB8

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ITGB8Integrin beta-8

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human, Rat, Mouse MYOG antibody
P0788 100ul

Human, Rat, Mouse MYOG antibody

Sign In for Pricing
View Details
Anti- Hormonally up-regulated neu tumor-associated kinase Antibody
GWB-1E134A 0.05 mL

Anti- Hormonally up-regulated neu tumor-associated kinase Antibody

Sign In for Pricing
View Details
Ethyl 2,3,4,6-tetra-O-benzyl-b-D-thiogalactopyranoside
GC7492-500mg 500 mg

Ethyl 2,3,4,6-tetra-O-benzyl-b-D-thiogalactopyranoside

Sign In for Pricing
View Details
Retinoic Acid Receptor alpha (RARA) (NM_001145301) Human Tagged Lenti ORF Clone
RC227974L4 10 µg

Retinoic Acid Receptor alpha (RARA) (NM_001145301) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human PRPH knockout cell line
ABC-KH12208 1 Vial

Human PRPH knockout cell line

Sign In for Pricing
View Details
Synj2 (NM_011523) Mouse Tagged ORF Clone Lentiviral Particle
MR218552L4V 200 µL

Synj2 (NM_011523) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details