Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Interleukin-6 (IL6)

Recombinant Sheep Interleukin-6 (IL6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries) . Target Name: IL6. Target Synonyms: IL6; Interleukin-6; IL-6. Accession Number: P29455. Expression Region: 30~208aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 47.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Sheep Interleukin-6 (IL6) is a purified Recombinant Protein.

Accession Number

P29455

Expression Region

30~208aa

Host

E. coli

Target

IL6

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL6; Interleukin-6; IL-6

Species

Sheep (Ovis aries)

Protein Name

Recombinant Protein

AA Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken C-Type Lectin Domain Family 3, Member B ELISA Kit
MBS062948 Inquire

Chicken C-Type Lectin Domain Family 3, Member B ELISA Kit

Sign In for Pricing
View Details
MRI1 (NM_001031727) Human Over-expression Lysate
LY422176 100 µg

MRI1 (NM_001031727) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human LY6D sgRNA gene knockout kit - Lentiviral human LY6D sgRNA gene knockout kit (100)
GTR15369271 1 Vial

Lentiviral human LY6D sgRNA gene knockout kit - Lentiviral human LY6D sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TRNASUP4P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48399111 3x 1.0 µg

TRNASUP4P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Danio rerio atg5 Rabbit Polyclonal Antibody (HRP)
orb2985678 200 µL

Danio rerio atg5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Nox4 CRISPR Activation Plasmid (h2)
sc-400298-ACT-2 20 µg

Nox4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details