Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Interleukin-6 (IL6)

Recombinant Sheep Interleukin-6 (IL6) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries) . Target Name: IL6. Target Synonyms: IL6; Interleukin-6; IL-6. Accession Number: P29455. Expression Region: 30~208aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 47.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Sheep Interleukin-6 (IL6) is a purified Recombinant Protein.

Accession Number

P29455

Expression Region

30~208aa

Host

E. coli

Target

IL6

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL6; Interleukin-6; IL-6

Species

Sheep (Ovis aries)

Protein Name

Recombinant Protein

AA Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Protein ABHD13 ABHD13 Antibody
A16332 100 µL

Anti-Protein ABHD13 ABHD13 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Tent2 shRNA (UAS) - Lentiviral mouse Tent2 shRNA (UAS, iRFP) plasmid
GTR15171880 1 Vial

Lentiviral mouse Tent2 shRNA (UAS) - Lentiviral mouse Tent2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
FBXO47 Double Nickase Plasmid (h2)
sc-416076-NIC-2 20 µg

FBXO47 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
IGBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24300061 1.0 µg DNA

IGBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DNA Polymerase gamma Polyclonal Antibody
E-AB-92871-01 60 µL

DNA Polymerase gamma Polyclonal Antibody

Sign In for Pricing
View Details
DNA Polymerase gamma Polyclonal Antibody
E-AB-92871-02 120 µL

DNA Polymerase gamma Polyclonal Antibody

Sign In for Pricing
View Details