Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heme oxygenase 1 (HMOX1), partial

Recombinant Human Heme oxygenase 1 (HMOX1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HMOX1. Target Synonyms: 32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32. Accession Number: P09601. Expression Region: 3~288aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Heme oxygenase 1 (HMOX1), partial is a purified Recombinant Protein.

Accession Number

P09601

Expression Region

3~288aa

Host

E. coli

Target

HMOX1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO3a (Phospho-S253) Conjugated Antibody
orb1612508 100 µL

FOXO3a (Phospho-S253) Conjugated Antibody

Sign In for Pricing
View Details
ARHGEF1 Antibody (N-term)
orb1436029-01 50 µL

ARHGEF1 Antibody (N-term)

Sign In for Pricing
View Details
ARHGEF1 Antibody (N-term)
orb1436029-02 100 µL

ARHGEF1 Antibody (N-term)

Sign In for Pricing
View Details
Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp18 (tvp18)
MBS7072065-01 0.05 mg (E-Coli)

Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp18 (tvp18)

Sign In for Pricing
View Details
Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp18 (tvp18)
MBS7072065-02 0.05 mg (Yeast)

Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp18 (tvp18)

Sign In for Pricing
View Details
Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp18 (tvp18)
MBS7072065-03 0.2 mg (E-Coli)

Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp18 (tvp18)

Sign In for Pricing
View Details