Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone H2B type 1-M (Hist1h2bm)

Recombinant Mouse Histone H2B type 1-M (Hist1h2bm) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Hist1h2bm. Target Synonyms: H2B 291B. Accession Number: P10854. Expression Region: 2~126aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Histone H2B type 1-M (Hist1h2bm) is a purified Recombinant Protein.

Accession Number

P10854

Expression Region

2~126aa

Host

E. coli

Target

Hist1h2bm

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

H2B 291B

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SF3B4, ID (SF3B4, SAP49, Splicing factor 3B subunit 4, Pre-mRNA-splicing factor SF3b 49kD subunit, SF3b50, Spliceosome-associated protein 49) (Biotin) discontinued
041616-Biotin 200 µL

SF3B4, ID (SF3B4, SAP49, Splicing factor 3B subunit 4, Pre-mRNA-splicing factor SF3b 49kD subunit, SF3b50, Spliceosome-associated protein 49) (Biotin) discontinued

Sign In for Pricing
View Details
RANBP3 Antibody
A67641-100UL 100 µL

RANBP3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal mu Crystallin Antibody
NBP2-55172-25ul 25 µL

Rabbit Polyclonal mu Crystallin Antibody

Sign In for Pricing
View Details
Rpl26 Mouse qPCR Primer Pair (NM_009080)
MP212871 200 Reactions

Rpl26 Mouse qPCR Primer Pair (NM_009080)

Sign In for Pricing
View Details
Activin B (Activin beta, Activin beta C Chain, Inhibin beta C Chain, IHBC, INHBC) (Biotin) discontinued
A0855-93H-Biotin 100 µL

Activin B (Activin beta, Activin beta C Chain, Inhibin beta C Chain, IHBC, INHBC) (Biotin) discontinued

Sign In for Pricing
View Details
CMA1 Antibody, FITC conjugated
A17610-100UG 100 µg

CMA1 Antibody, FITC conjugated

Sign In for Pricing
View Details