Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A type 1 (HIST1H2AG)

Recombinant Human Histone H2A type 1 (HIST1H2AG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HIST1H2AG. Target Synonyms: Histone H2A/p. Accession Number: P0C0S8. Expression Region: 2~130aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Histone H2A type 1 (HIST1H2AG) is a purified Recombinant Protein.

Accession Number

P0C0S8

Expression Region

2~130aa

Host

E. coli

Target

HIST1H2AG

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Histone H2A/p

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf45 Rabbit Polyclonal Antibody (BF647)
orb2507606 100 µL

C8orf45 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Human cutaneous T cell-attracting ckine (CTACK/CCL27) ELISA Kit
201-12-0061 96 Tests

Human cutaneous T cell-attracting ckine (CTACK/CCL27) ELISA Kit

Sign In for Pricing
View Details
Human IZUMO1R Pre-designed siRNA Set B
SI007882B 1 Each

Human IZUMO1R Pre-designed siRNA Set B

Sign In for Pricing
View Details
E2F1 Protein Vector (Mouse) (pPM-C-HA)
18827024 500 ng

E2F1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TOR1A AAV Vector (Human) (CMV)
47314101 1 µg

TOR1A AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
1- (3,4-Dihydro-2H-1,5-benzodioxepin-7-yl) -2-methylpropan-1-amine
XIB83746-01 100 mg

1- (3,4-Dihydro-2H-1,5-benzodioxepin-7-yl) -2-methylpropan-1-amine

Sign In for Pricing
View Details