Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A type 1 (HIST1H2AG)

Recombinant Human Histone H2A type 1 (HIST1H2AG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HIST1H2AG. Target Synonyms: Histone H2A/p. Accession Number: P0C0S8. Expression Region: 2~130aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Histone H2A type 1 (HIST1H2AG) is a purified Recombinant Protein.

Accession Number

P0C0S8

Expression Region

2~130aa

Host

E. coli

Target

HIST1H2AG

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Histone H2A/p

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PHLDA2 (C-6His)
PEH1321-01 10 µg

Recombinant Human PHLDA2 (C-6His)

Sign In for Pricing
View Details
Recombinant Human PHLDA2 (C-6His)
PEH1321-02 50 µg

Recombinant Human PHLDA2 (C-6His)

Sign In for Pricing
View Details
Recombinant Human PHLDA2 (C-6His)
PEH1321-03 500 µg

Recombinant Human PHLDA2 (C-6His)

Sign In for Pricing
View Details
OXR1 Antibody, Biotin conjugated
A65588-50UG 50 µg

OXR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human Dynein, Axonemal, Heavy Chain 11 (DNAH11) ELISA Kit
YLA3306HU-01 48 Tests

Human Dynein, Axonemal, Heavy Chain 11 (DNAH11) ELISA Kit

Sign In for Pricing
View Details
Human Dynein, Axonemal, Heavy Chain 11 (DNAH11) ELISA Kit
YLA3306HU-02 96 Tests

Human Dynein, Axonemal, Heavy Chain 11 (DNAH11) ELISA Kit

Sign In for Pricing
View Details