Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Glutathione S-transferase P (Gstp1)

Recombinant Rat Glutathione S-transferase P (Gstp1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Gstp1. Target Synonyms: Chain 7GST 7-7GST class-pi. Accession Number: P04906. Expression Region: 2~210aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Glutathione S-transferase P (Gstp1) is a purified Recombinant Protein.

Accession Number

P04906

Expression Region

2~210aa

Host

E. coli

Target

Gstp1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Chain 7GST 7-7GST class-pi

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)
MBS2111287-01 0.1 mL

Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)

Sign In for Pricing
View Details
Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)
MBS2111287-02 0.2 mL

Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)

Sign In for Pricing
View Details
Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)
MBS2111287-03 0.5 mL

Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)

Sign In for Pricing
View Details
Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)
MBS2111287-04 1 mL

Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)

Sign In for Pricing
View Details
Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)
MBS2111287-05 5 mL

Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)

Sign In for Pricing
View Details
Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)
MBS2111287-06 5x 5 mL

Monoclonal Antibody to Thymidine Kinase 1, Soluble (TK1)

Sign In for Pricing
View Details