Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Frataxin, mitochondrial (Fxn)

Recombinant Mouse Frataxin, mitochondrial (Fxn) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Fxn. Target Synonyms: Fxn; FrdaFrataxin; mitochondrial; Fxn; EC 1.16.3.1; Cleaved into: Frataxin intermediate form; Frataxin mature form. Accession Number: O35943. Expression Region: 78~207aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Frataxin, mitochondrial (Fxn) is a purified Recombinant Protein.

Accession Number

O35943

Expression Region

78~207aa

Host

E. coli

Target

Fxn

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fxn; FrdaFrataxin; mitochondrial; Fxn; EC 1.16.3.1; Cleaved into: Frataxin intermediate form; Frataxin mature form

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL17RD, NT (IL17RD, IL17RLM, SEF, Interleukin-17 receptor D, IL17Rhom, Interleukin-17 receptor-like protein, Sef homolog) (MaxLight 490) discontinued
036983-ML490 100 µL

IL17RD, NT (IL17RD, IL17RLM, SEF, Interleukin-17 receptor D, IL17Rhom, Interleukin-17 receptor-like protein, Sef homolog) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SAMHD1 antibody
70R-12747 100 µL

SAMHD1 antibody

Sign In for Pricing
View Details
SPDYE5 sgRNA CRISPR Lentivector set (Human)
K2270601 3x 1.0 µg

SPDYE5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Canine CD2 antigen cytoplasmic tail binding protein 2 (CD2BP2) ELISA kit
GTR10394638 96 Well

Canine CD2 antigen cytoplasmic tail binding protein 2 (CD2BP2) ELISA kit

Sign In for Pricing
View Details
TAF9B siRNA (Human)
MBS8238284-01 15 nmol

TAF9B siRNA (Human)

Sign In for Pricing
View Details
TAF9B siRNA (Human)
MBS8238284-02 30 nmol

TAF9B siRNA (Human)

Sign In for Pricing
View Details