Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human fMet-Leu-Phe receptor (FPR1), partial

Recombinant Human fMet-Leu-Phe receptor (FPR1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FPR1. Target Synonyms: N-formyl peptide receptorFPRN-formylpeptide chemoattractant receptor. Accession Number: P21462. Expression Region: 306~350aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human fMet-Leu-Phe receptor (FPR1), partial is a purified Recombinant Protein.

Accession Number

P21462

Expression Region

306~350aa

Host

E. coli

Target

FPR1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

N-formyl peptide receptorFPRN-formylpeptide chemoattractant receptor

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LXS196 1mg
A19419-1 1 mg

LXS196 1mg

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Magnetic Fluorescence Assay Kit
MBS2159440-01 96 Tests

Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Magnetic Fluorescence Assay Kit
MBS2159440-02 5x 96 Tests

Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Magnetic Fluorescence Assay Kit
MBS2159440-03 10x 96 Tests

Protein Tyrosine Phosphatase Receptor Type G (PTPRG) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
CTRB1 Protein, Human, Recombinant (His)
MF-0106785-01 5 µg

CTRB1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
CTRB1 Protein, Human, Recombinant (His)
MF-0106785-02 10 µg

CTRB1 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details