Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein delta homolog 1 (DLK1), partial

Recombinant Human Protein delta homolog 1 (DLK1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DLK1. Target Synonyms: pG2. Accession Number: P80370. Expression Region: 24~303aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein delta homolog 1 (DLK1), partial is a purified Recombinant Protein.

Accession Number

P80370

Expression Region

24~303aa

Host

E. coli

Target

DLK1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PG2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA3D Recombinant Protein (Mouse)
RP170687 100 µg

SEMA3D Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Respiratory Syncytial Virus Nucleoprotein Antibody (1C3) [CoraFluor 1]
NBP2-50534CL1 0.1 mL

Mouse Monoclonal Respiratory Syncytial Virus Nucleoprotein Antibody (1C3) [CoraFluor 1]

Sign In for Pricing
View Details
Reep4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3330003 1.0 µg DNA

Reep4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
WFIKKN2, CT (WFIKKN2, GASP1, WFIKKNRP, WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 2, Growth and differentiation factor-associated serum protein 1, WAP, follistatin, immunoglobulin, kunitz and NTR domain-containing-related protein
MBS6363561-01 0.1 mL

WFIKKN2, CT (WFIKKN2, GASP1, WFIKKNRP, WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 2, Growth and differentiation factor-associated serum protein 1, WAP, follistatin, immunoglobulin, kunitz and NTR domain-containing-related protein

Sign In for Pricing
View Details
WFIKKN2, CT (WFIKKN2, GASP1, WFIKKNRP, WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 2, Growth and differentiation factor-associated serum protein 1, WAP, follistatin, immunoglobulin, kunitz and NTR domain-containing-related protein
MBS6363561-02 5x 0.1 mL

WFIKKN2, CT (WFIKKN2, GASP1, WFIKKNRP, WAP, kazal, immunoglobulin, kunitz and NTR domain-containing protein 2, Growth and differentiation factor-associated serum protein 1, WAP, follistatin, immunoglobulin, kunitz and NTR domain-containing-related protein

Sign In for Pricing
View Details
Bovine Tumor suppressor candidate 2 (TUSC2) ELISA Kit
EIA06736Bo 1 Kit

Bovine Tumor suppressor candidate 2 (TUSC2) ELISA Kit

Sign In for Pricing
View Details