Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ctla4. Target Synonyms: Cytotoxic T-lymphocyte-associated antigen 4. Accession Number: P09793. Expression Region: 36~161aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is a purified Recombinant Protein.

Accession Number

P09793

Expression Region

36~161aa

Host

E. coli

Target

Ctla4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytotoxic T-lymphocyte-associated antigen 4

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit
DLR-FMO1-Hu-96T 96 Tests

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse EFNB1 Protein, C-Fc-His
EMF79701 100 μg

Recombinant Mouse EFNB1 Protein, C-Fc-His

Sign In for Pricing
View Details
PRF1 (Perforin 1) Mouse ELISA Kit
G0817 96 Tests

PRF1 (Perforin 1) Mouse ELISA Kit

Sign In for Pricing
View Details
MPFD sgRNA CRISPR Lentivector (Human) (Target 3)
K1319904 1.0 µg DNA

MPFD sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TIGD7 Antibody
orb33043-01 50 µg

TIGD7 Antibody

Sign In for Pricing
View Details
TIGD7 Antibody
orb33043-02 100 µg

TIGD7 Antibody

Sign In for Pricing
View Details