Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ctla4. Target Synonyms: Cytotoxic T-lymphocyte-associated antigen 4. Accession Number: P09793. Expression Region: 36~161aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4), partial is a purified Recombinant Protein.

Accession Number

P09793

Expression Region

36~161aa

Host

E. coli

Target

Ctla4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytotoxic T-lymphocyte-associated antigen 4

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Centromere protein K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-8459R-BF680 100 µL

Centromere protein K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
JAK1 Antibody
MBS7136566-01 0.05 mL

JAK1 Antibody

Sign In for Pricing
View Details
JAK1 Antibody
MBS7136566-02 0.1 mL

JAK1 Antibody

Sign In for Pricing
View Details
JAK1 Antibody
MBS7136566-03 5x 0.1 mL

JAK1 Antibody

Sign In for Pricing
View Details
NDUFB11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12H10]
TA807792AM 100 µL

NDUFB11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12H10]

Sign In for Pricing
View Details
Kv beta 1 (KCNAB1) (NM_172160) Human Over-expression Lysate
LH15059V 100 µg

Kv beta 1 (KCNAB1) (NM_172160) Human Over-expression Lysate

Sign In for Pricing
View Details