Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad)

Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Csad. Target Synonyms: Cysteine-sulfinate decarboxylase; Sulfinoalanine decarboxylase. Accession Number: Q9DBE0. Expression Region: 1~493aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 71.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad) is a purified Recombinant Protein.

Accession Number

Q9DBE0

Expression Region

1~493aa

Host

E. coli

Target

Csad

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

71.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cysteine-sulfinate decarboxylase; Sulfinoalanine decarboxylase

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL27 Human Pre-designed siRNA Set A
HY-RS12180 1 Set

RPL27 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human CDK5RAP3 knockout cell line
ABC-KH2841 1 Vial

Human CDK5RAP3 knockout cell line

Sign In for Pricing
View Details
SORBS2 (NM_001145670) Human Tagged ORF Clone Lentiviral Particle
RC227264L4V 200 µL

SORBS2 (NM_001145670) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (MaxLight 650) discontinued
C2097-69L-ML650 100 µL

CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (MaxLight 650) discontinued

Sign In for Pricing
View Details
UBAP1 Antibody, Biotin conjugated
A68536-50UG 50 µg

UBAP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-Human EPHB1 Antibody (SAA1648)
HX122013-01 50 µg

Anti-Human EPHB1 Antibody (SAA1648)

Sign In for Pricing
View Details