Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COX4I1. Target Synonyms: Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1; COX IV-1. Accession Number: P13073. Expression Region: 23~169aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is a purified Recombinant Protein.

Accession Number

P13073

Expression Region

23~169aa

Host

E. coli

Target

COX4I1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1; COX IV-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRK siRNA (Mouse)
MBS8222231-01 15 nmol

CRK siRNA (Mouse)

Sign In for Pricing
View Details
CRK siRNA (Mouse)
MBS8222231-02 30 nmol

CRK siRNA (Mouse)

Sign In for Pricing
View Details
CRK siRNA (Mouse)
MBS8222231-03 5x 30 nmol

CRK siRNA (Mouse)

Sign In for Pricing
View Details
BZRPL1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0203903 1.0 µg DNA

BZRPL1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ARL3 siRNA (Human)
CRH0292-01 15 nmol

ARL3 siRNA (Human)

Sign In for Pricing
View Details
ARL3 siRNA (Human)
CRH0292-02 30 nmol

ARL3 siRNA (Human)

Sign In for Pricing
View Details