Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COX4I1. Target Synonyms: Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1; COX IV-1. Accession Number: P13073. Expression Region: 23~169aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is a purified Recombinant Protein.

Accession Number

P13073

Expression Region

23~169aa

Host

E. coli

Target

COX4I1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1; COX IV-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLIT3  (1D11)
YF-MA15456 100 ug

Anti-SLIT3 (1D11)

Sign In for Pricing
View Details
Recombinant Guinea pig IL6 protein, N-His Tag
IMP-2930 10 µg

Recombinant Guinea pig IL6 protein, N-His Tag

Sign In for Pricing
View Details
Coq4 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7216002 1.0 µg DNA

Coq4 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Psg18 Protein Lysate (Mouse) with C-HA Tag
37910034 100 µg

Psg18 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Mouse IL6/ Interleukin-6 Protein, Untagged, E.coli-2ug
QP1487-2ug 2ug

Recombinant Mouse IL6/ Interleukin-6 Protein, Untagged, E.coli-2ug

Sign In for Pricing
View Details
COX2 Inhibitor Screening Assay Kit
82210 96 Reactions

COX2 Inhibitor Screening Assay Kit

Sign In for Pricing
View Details