Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COX4I1. Target Synonyms: Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1; COX IV-1. Accession Number: P13073. Expression Region: 23~169aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1) is a purified Recombinant Protein.

Accession Number

P13073

Expression Region

23~169aa

Host

E. coli

Target

COX4I1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytochrome c oxidase polypeptide IVCytochrome c oxidase subunit IV isoform 1; COX IV-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGP2 Antibody, FITC conjugated
A55359-100UG 100 µg

UGP2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Glass Wool
2069340 1 Each

Glass Wool

Sign In for Pricing
View Details
High Mobility Group Protein 1
547513 200 µL

High Mobility Group Protein 1

Sign In for Pricing
View Details
LIM And Senescent Cell Antigen Like Domains Protein 1 (LIMS1) Antibody (FITC)
abx336373-01 20 µg

LIM And Senescent Cell Antigen Like Domains Protein 1 (LIMS1) Antibody (FITC)

Sign In for Pricing
View Details
LIM And Senescent Cell Antigen Like Domains Protein 1 (LIMS1) Antibody (FITC)
abx336373-02 50 µg

LIM And Senescent Cell Antigen Like Domains Protein 1 (LIMS1) Antibody (FITC)

Sign In for Pricing
View Details
LIM And Senescent Cell Antigen Like Domains Protein 1 (LIMS1) Antibody (FITC)
abx336373-03 100 µg

LIM And Senescent Cell Antigen Like Domains Protein 1 (LIMS1) Antibody (FITC)

Sign In for Pricing
View Details