Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-3 (IV) chain (COL4A3), partial

Recombinant Human Collagen alpha-3 (IV) chain (COL4A3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COL4A3. Target Synonyms: Goodpasture antigen. Accession Number: Q01955. Expression Region: 1427~1668aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Collagen alpha-3 (IV) chain (COL4A3), partial is a purified Recombinant Protein.

Accession Number

Q01955

Expression Region

1427~1668aa

Host

E. coli

Target

COL4A3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Adhesion

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Goodpasture antigen

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human L3MBTL2 IP Antibody
ANT-36084-100ug 100 µg

Human L3MBTL2 IP Antibody

Sign In for Pricing
View Details
Bovine Surfactant Associated Protein D (SPD) ELISA Kit
MBS2609798-01 48 Well

Bovine Surfactant Associated Protein D (SPD) ELISA Kit

Sign In for Pricing
View Details
Bovine Surfactant Associated Protein D (SPD) ELISA Kit
MBS2609798-02 96 Well

Bovine Surfactant Associated Protein D (SPD) ELISA Kit

Sign In for Pricing
View Details
Bovine Surfactant Associated Protein D (SPD) ELISA Kit
MBS2609798-03 5x 96 Well

Bovine Surfactant Associated Protein D (SPD) ELISA Kit

Sign In for Pricing
View Details
Bovine Surfactant Associated Protein D (SPD) ELISA Kit
MBS2609798-04 10x 96 Well

Bovine Surfactant Associated Protein D (SPD) ELISA Kit

Sign In for Pricing
View Details
RTP2 Human Pre-designed siRNA Set A
HY-RS12337 1 Set

RTP2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details