Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COL4A1. Target Synonyms: Arresten; BSVD; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1 (IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide. Accession Number: P02462. Expression Region: 1445~1669aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 40.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial is a purified Recombinant Protein.

Accession Number

P02462

Expression Region

1445~1669aa

Host

E. coli

Target

COL4A1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Arresten; BSVD; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1 (IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide; Collagen Of Basement Membrane Alpha 1 Chain; Collagen Of Basement Membrane Alpha 2 Chain; Collagen Type IV Alpha 1; collagen type IV alpha 1 chain; Collagen Type IV Alpha 2; Collagen Type IV Alpha 3; Collagen Type IV Alpha 4; Collagen Type IV Alpha 5; RATOR

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM6A (NM_001291418) Human Tagged ORF Clone
RG240108 10 µg

KDM6A (NM_001291418) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sheep Cadherin 18 (CDH18) ELISA kit
GTR10406094 96 Well

Sheep Cadherin 18 (CDH18) ELISA kit

Sign In for Pricing
View Details
atg5 Blocking Peptide (Center)
MBS9229786-01 0.5 mg

atg5 Blocking Peptide (Center)

Sign In for Pricing
View Details
atg5 Blocking Peptide (Center)
MBS9229786-02 5x 0.5 mg

atg5 Blocking Peptide (Center)

Sign In for Pricing
View Details
Lrit1 (NM_146245) Mouse Tagged ORF Clone Lentiviral Particle
MR209465L4V 200 µL

Lrit1 (NM_146245) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Streptomyces griseus subsp. griseus UPF0271 protein SGR_3193 (SGR_3193)
MBS1249824-01 0.02 mg (E-Coli)

Recombinant Streptomyces griseus subsp. griseus UPF0271 protein SGR_3193 (SGR_3193)

Sign In for Pricing
View Details