Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: COL4A1. Target Synonyms: Arresten; BSVD; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1 (IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide. Accession Number: P02462. Expression Region: 1445~1669aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 40.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial is a purified Recombinant Protein.

Accession Number

P02462

Expression Region

1445~1669aa

Host

E. coli

Target

COL4A1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Arresten; BSVD; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1 (IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide; Collagen Of Basement Membrane Alpha 1 Chain; Collagen Of Basement Membrane Alpha 2 Chain; Collagen Type IV Alpha 1; collagen type IV alpha 1 chain; Collagen Type IV Alpha 2; Collagen Type IV Alpha 3; Collagen Type IV Alpha 4; Collagen Type IV Alpha 5; RATOR

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-Triethylsilyldocetaxel
022215 5 mg

2'-Triethylsilyldocetaxel

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)
MBS2068306-01 0.1 mL

HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)
MBS2068306-02 0.2 mL

HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)
MBS2068306-03 0.5 mL

HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)
MBS2068306-04 1 mL

HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)
MBS2068306-05 5 mL

HRP-Linked Polyclonal Antibody to Toll Interacting Protein (TOLLIP)

Sign In for Pricing
View Details