Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CHRNA1. Target Synonyms: Acetylcholine receptor subunit alpha; ACHA_HUMAN; AChR; ACHRA; ACHRD; CHNRA; Cholinergic receptor nicotinic alpha 1 subunit; Cholinergic receptor nicotinic alpha polypeptide 1; Cholinergic receptor; nicotinic. Accession Number: P02708. Expression Region: 21~255aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 31.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein.

Accession Number

P02708

Expression Region

21~255aa

Host

E. coli

Target

CHRNA1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Transport

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial of P02708-1

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Acetylcholine receptor subunit alpha; ACHA_HUMAN; AChR; ACHRA; ACHRD; CHNRA; Cholinergic receptor nicotinic alpha 1 subunit; Cholinergic receptor nicotinic alpha polypeptide 1; Cholinergic receptor; nicotinic; alpha polypeptide 1 (muscle) ; Chrna1; CMS1A; CMS1B; CMS2A; FCCMS; Nicotinic cholinergic receptor alpha 1; SCCMS; Schizophrenia neurophysiologic defect candidate

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7208276-01 48 Well

Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7208276-02 96 Well

Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7208276-03 5x 96 Well

Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit
MBS7208276-04 10x 96 Well

Rat ADP-ribosylation factor-like protein 2 (ARL2) ELISA Kit

Sign In for Pricing
View Details
1000 ug/mL Famoxadone in HPLC Acetone - 1ML
LCS-5462 1 mL

1000 ug/mL Famoxadone in HPLC Acetone - 1ML

Sign In for Pricing
View Details
Guinea Pig Receptor Interacting Serine Threonine Kinase 3 ELISA Kit
MBS7258110-01 48 Well

Guinea Pig Receptor Interacting Serine Threonine Kinase 3 ELISA Kit

Sign In for Pricing
View Details