Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial

Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD33. Target Synonyms: Sialic acid-binding Ig-like lectin 3Siglec-3gp67CD_antigen: CD33SIGLEC3. Accession Number: P20138. Expression Region: 18~259aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 46.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Myeloid cell surface antigen CD33 (CD33), partial is a purified Recombinant Protein.

Accession Number

P20138

Expression Region

18~259aa

Host

E. coli

Target

CD33

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Sialic acid-binding Ig-like lectin 3Siglec-3gp67CD_antigen: CD33SIGLEC3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Senkyunolide I 1mg
A14854-1 1 mg

Senkyunolide I 1mg

Sign In for Pricing
View Details
E2A (phospho Thr355) Rabbit Polyclonal Antibody
APRab04569-01 20 µL

E2A (phospho Thr355) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
E2A (phospho Thr355) Rabbit Polyclonal Antibody
APRab04569-02 50 µL

E2A (phospho Thr355) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
E2A (phospho Thr355) Rabbit Polyclonal Antibody
APRab04569-03 100 µL

E2A (phospho Thr355) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
E2A (phospho Thr355) Rabbit Polyclonal Antibody
APRab04569-04 200 µL

E2A (phospho Thr355) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal EGF Antibody (RM0078-2M13) [HRP]
NBP1-21708H 0.1 mL

Rat Monoclonal EGF Antibody (RM0078-2M13) [HRP]

Sign In for Pricing
View Details