Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chromobox protein homolog 7 (CBX7)

Recombinant Human Chromobox protein homolog 7 (CBX7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CBX7. Target Synonyms: CBX7; Chromobox protein homolog 7. Accession Number: O95931. Expression Region: 1~251aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Chromobox protein homolog 7 (CBX7) is a purified Recombinant Protein.

Accession Number

O95931

Expression Region

1~251aa

Host

E. coli

Target

CBX7

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Transcription

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CBX7; Chromobox protein homolog 7

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL
BNC402897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF594 conjugate, 0.1mg/mL
BNC942889-100 1x 100 µL

Secretory Component / ECM1 (ECM1/2889R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2), CF405S conjugate, 0.1mg/mL
BNC040056-100 1x 100 µL

CD74 (LN-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details