Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calreticulin (Calr)

Recombinant Mouse Calreticulin (Calr) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Calr. Target Synonyms: CRP55Calregulin; Endoplasmic reticulum resident protein 60; ERp60HACBP. Accession Number: P14211. Expression Region: 18~416aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 73.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Calreticulin (Calr) is a purified Recombinant Protein.

Accession Number

P14211

Expression Region

18~416aa

Host

E. coli

Target

Calr

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

73.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CRP55Calregulin; Endoplasmic reticulum resident protein 60; ERp60HACBP

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 Peptide - N-terminal region
MBS3240026-01 0.1 mg

CD9 Peptide - N-terminal region

Sign In for Pricing
View Details
CD9 Peptide - N-terminal region
MBS3240026-02 5x 0.1 mg

CD9 Peptide - N-terminal region

Sign In for Pricing
View Details
Anti-HSD17B1 Rabbit Monoclonal Antibody
MA3112-.05 50 µL

Anti-HSD17B1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CHSY3 Antibody
60-828 400 µL

CHSY3 Antibody

Sign In for Pricing
View Details
Xpress™ Human GALNT4 Over-expressing Stable Cell Line
ABC-X1191 1 Vial

Xpress™ Human GALNT4 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit A (nuoA)
MBS7023747-01 0.02 mg

Recombinant Desulfitobacterium hafniense NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details