Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin (CALR)

Recombinant Human Calreticulin (CALR) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CALR. Target Synonyms: CRP55CalregulinEndoplasmic reticulum resident protein 60HACBPgrp60CRTC. Accession Number: P27797. Expression Region: 18~417aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 73.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Calreticulin (CALR) is a purified Recombinant Protein.

Accession Number

P27797

Expression Region

18~417aa

Host

E. coli

Target

CALR

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

73.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CRP55CalregulinEndoplasmic reticulum resident protein 60HACBPgrp60CRTC

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fezf2 ORF Vector (Mouse) (pORF)
20470014 1.0 µg DNA

Fezf2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
TRPC3 sgRNA CRISPR Lentivector (Human) (Target 3)
K2535204 1.0 µg DNA

TRPC3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
3-[4- (ethylthio) phenyl]-1-phenyl-1H-pyrazole-4-carbaldehyde
sc-345973A 5 g

3-[4- (ethylthio) phenyl]-1-phenyl-1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
Ap3s1 ORF Vector (Mouse) (pORF)
ORF038760 1.0 µg DNA

Ap3s1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Human SDR42E1 Knockout HEK293T cell line
GTR15421767 1 Vial

Human SDR42E1 Knockout HEK293T cell line

Sign In for Pricing
View Details
PKIG ORF Vector (Human) (pORF)
ORF014082 1.0 µg DNA

PKIG ORF Vector (Human) (pORF)

Sign In for Pricing
View Details