Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin (CALR)

Recombinant Human Calreticulin (CALR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CALR. Target Synonyms: CRP55CalregulinEndoplasmic reticulum resident protein 60. Accession Number: P27797. Expression Region: 18~417aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Calreticulin (CALR) is a purified Recombinant Protein.

Accession Number

P27797

Expression Region

18~417aa

Host

E. coli

Target

CALR

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CRP55CalregulinEndoplasmic reticulum resident protein 60

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTSJD2 Recombinant Protein Antigen
NBP1-83048PEP 0.1 mL

FTSJD2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Phospho-AS160 (Thr642) (18O13) Rabbit Monoclonal Antibody
E28M2044 100 µL

Phospho-AS160 (Thr642) (18O13) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-MMP2 Polyclonal Antibody
PHC32301 100 μg

Anti-MMP2 Polyclonal Antibody

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2076718-01 0.1 mL

PE-Linked Polyclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2076718-02 0.2 mL

PE-Linked Polyclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2076718-03 0.5 mL

PE-Linked Polyclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details