Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Biglycan (BGN)

Recombinant Human Biglycan (BGN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: BGN. Target Synonyms: Bone/cartilage proteoglycan IPG-S1. Accession Number: P21810. Expression Region: 38~368aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 57.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Biglycan (BGN) is a purified Recombinant Protein.

Accession Number

P21810

Expression Region

38~368aa

Host

E. coli

Target

BGN

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Bone/cartilage proteoglycan IPG-S1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KBTBD5 antibody - C-terminal region
MBS3204899-01 0.1 mL

KBTBD5 antibody - C-terminal region

Sign In for Pricing
View Details
KBTBD5 antibody - C-terminal region
MBS3204899-02 5x 0.1 mL

KBTBD5 antibody - C-terminal region

Sign In for Pricing
View Details
Rat Glutaredoxin 3 ELISA Kit
MBS055932-01 48 Well

Rat Glutaredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Rat Glutaredoxin 3 ELISA Kit
MBS055932-02 96 Well

Rat Glutaredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Rat Glutaredoxin 3 ELISA Kit
MBS055932-03 5x 96 Well

Rat Glutaredoxin 3 ELISA Kit

Sign In for Pricing
View Details
Rat Glutaredoxin 3 ELISA Kit
MBS055932-04 10x 96 Well

Rat Glutaredoxin 3 ELISA Kit

Sign In for Pricing
View Details