Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Bcl2. Target Synonyms: Bcl2; Bcl-2; Apoptosis regulator Bcl-2. Accession Number: P10417. Expression Region: 5~205aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial is a purified Recombinant Protein.

Accession Number

P10417

Expression Region

5~205aa

Host

E. coli

Target

Bcl2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Bcl2; Bcl-2; Apoptosis regulator Bcl-2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tbc1d20 shRNA (UAS) - Lentiviral mouse Tbc1d20 shRNA (UAS, iRFP) (25)
GTR15296849 1 Vial

Lentiviral mouse Tbc1d20 shRNA (UAS) - Lentiviral mouse Tbc1d20 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque SLC1A3 Protein, His (Fc)-Avi-tagged
SLC1A3-4047R 50 µg

Recombinant Rhesus Macaque SLC1A3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
RBPJK Polyclonal Antibody, HRP Conjugated
bs-2966R-HRP-TR 20 µL

RBPJK Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), CF647 conjugate, 0.1mg/mL
BNC471746-100 1x 100 µL

Human Herpes Virus 8 (HHV8) (LN53), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat Synj2bp ELISA Kit
ELI-46230r 96 Tests

Rat Synj2bp ELISA Kit

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor, ErbB-1, HER1)
216481 50 µg

EGFR (Epidermal Growth Factor Receptor, ErbB-1, HER1)

Sign In for Pricing
View Details