Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Bcl2. Target Synonyms: Bcl2; Bcl-2; Apoptosis regulator Bcl-2. Accession Number: P10417. Expression Region: 5~205aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial is a purified Recombinant Protein.

Accession Number

P10417

Expression Region

5~205aa

Host

E. coli

Target

Bcl2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Bcl2; Bcl-2; Apoptosis regulator Bcl-2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2-chloro-4,4,4-trifluoroacetoacetate
sc-263185 10 g

Ethyl 2-chloro-4,4,4-trifluoroacetoacetate

Sign In for Pricing
View Details
GENLISA™ Human Immune Receptor Expressed On Myeloid Cells 1 (IREM1) ELISA
KBH21319 1x 96 Well

GENLISA™ Human Immune Receptor Expressed On Myeloid Cells 1 (IREM1) ELISA

Sign In for Pricing
View Details
mmu-miR-6928-5p Primers
MPM01669 150 µL / 10 µM

mmu-miR-6928-5p Primers

Sign In for Pricing
View Details
Sol i 4 Allergen Recombinant Protein (N-His)
ZC078012-01 50 µg

Sol i 4 Allergen Recombinant Protein (N-His)

Sign In for Pricing
View Details
Sol i 4 Allergen Recombinant Protein (N-His)
ZC078012-02 100 µg

Sol i 4 Allergen Recombinant Protein (N-His)

Sign In for Pricing
View Details
Sol i 4 Allergen Recombinant Protein (N-His)
ZC078012-03 1 mg

Sol i 4 Allergen Recombinant Protein (N-His)

Sign In for Pricing
View Details