Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial

Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: ATP5B. Target Synonyms: Atp5f1b; Atp5b; ATP synthase subunit beta; mitochondrial; EC 7.1.2.2; ATP synthase F1 subunit beta. Accession Number: P56480. Expression Region: 230~529aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 52.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse ATP synthase subunit beta, mitochondrial (ATP5B), partial is a purified Recombinant Protein.

Accession Number

P56480

Expression Region

230~529aa

Host

E. coli

Target

ATP5B

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Atp5f1b; Atp5b; ATP synthase subunit beta; mitochondrial; EC 7.1.2.2; ATP synthase F1 subunit beta

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cartilage Oligomeric Matrix Protein (COMP) ELISA Kit
RD-COMP-Ra-96Tests 96 Tests

Rat Cartilage Oligomeric Matrix Protein (COMP) ELISA Kit

Sign In for Pricing
View Details
Rat Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR) Elisa Kit
EK720234 96 Well

Rat Immunoglobulin superfamily containing leucine-rich repeat protein (ISLR) Elisa Kit

Sign In for Pricing
View Details
Sheep Presynaptic Membrane Receptor Antibody ELISA Kit
MBS042072-01 48 Well

Sheep Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Sheep Presynaptic Membrane Receptor Antibody ELISA Kit
MBS042072-02 96 Well

Sheep Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Sheep Presynaptic Membrane Receptor Antibody ELISA Kit
MBS042072-03 5x 96 Well

Sheep Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Sheep Presynaptic Membrane Receptor Antibody ELISA Kit
MBS042072-04 10x 96 Well

Sheep Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details