Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: ASGR2. Target Synonyms: Hepatic lectin 2. Accession Number: P24721. Expression Region: 80~301aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 45.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial is a purified Recombinant Protein.

Accession Number

P24721

Expression Region

80~301aa

Host

E. coli

Target

ASGR2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatic lectin 2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal STRA8 Antibody [mFluor Violet 610 SE]
NBP2-98691MFV610 0.1 mL

Rabbit Polyclonal STRA8 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Olr788 ORF Vector (Rat) (pORF)
ORF072788 1.0 µg DNA

Olr788 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PRR12 CRISPR Activation Plasmid (h2)
sc-412808-ACT-2 20 µg

PRR12 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
SLC25A16 antibody - N-terminal region
MBS3207219-01 0.1 mL

SLC25A16 antibody - N-terminal region

Sign In for Pricing
View Details
SLC25A16 antibody - N-terminal region
MBS3207219-02 5x 0.1 mL

SLC25A16 antibody - N-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal EGLN3/PHD3 Antibody [DyLight 594]
NB100-139DL594 0.1 mL

Rabbit Polyclonal EGLN3/PHD3 Antibody [DyLight 594]

Sign In for Pricing
View Details