Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Asgr2. Target Synonyms: Hepatic lectin 2HL-2mHL-2Asgr-2. Accession Number: P24721. Expression Region: 80~301aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial is a purified Recombinant Protein.

Accession Number

P24721

Expression Region

80~301aa

Host

E. coli

Target

Asgr2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatic lectin 2HL-2mHL-2Asgr-2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Tyrosine Hydroxylase (TH)
MBS2169540-01 0.1 mL

Monoclonal Antibody to Tyrosine Hydroxylase (TH)

Sign In for Pricing
View Details
Monoclonal Antibody to Tyrosine Hydroxylase (TH)
MBS2169540-02 0.2 mL

Monoclonal Antibody to Tyrosine Hydroxylase (TH)

Sign In for Pricing
View Details
Monoclonal Antibody to Tyrosine Hydroxylase (TH)
MBS2169540-03 0.5 mL

Monoclonal Antibody to Tyrosine Hydroxylase (TH)

Sign In for Pricing
View Details
Monoclonal Antibody to Tyrosine Hydroxylase (TH)
MBS2169540-04 1 mL

Monoclonal Antibody to Tyrosine Hydroxylase (TH)

Sign In for Pricing
View Details
Monoclonal Antibody to Tyrosine Hydroxylase (TH)
MBS2169540-05 5 mL

Monoclonal Antibody to Tyrosine Hydroxylase (TH)

Sign In for Pricing
View Details
Monoclonal Antibody to Tyrosine Hydroxylase (TH)
MBS2169540-06 5x 5 mL

Monoclonal Antibody to Tyrosine Hydroxylase (TH)

Sign In for Pricing
View Details