Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Asgr1. Target Synonyms: Hepatic lectin 1; HL-1; mHL-1. Accession Number: P34927. Expression Region: 61~284aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 52.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial is a purified Recombinant Protein.

Accession Number

P34927

Expression Region

61~284aa

Host

E. coli

Target

Asgr1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatic lectin 1; HL-1; mHL-1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudoalteromonas haloplanktis Chaperone protein htpG (htpG), partial
MBS1308954 Inquire

Recombinant Pseudoalteromonas haloplanktis Chaperone protein htpG (htpG), partial

Sign In for Pricing
View Details
Rabbit Anti-Human TLR8 pAb
PA6546-01 50 μL

Rabbit Anti-Human TLR8 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TLR8 pAb
PA6546-02 100 μL

Rabbit Anti-Human TLR8 pAb

Sign In for Pricing
View Details
Human TCTN1 (NP_001076006.1) VersaClone cDNA
RDC3034 10 µg

Human TCTN1 (NP_001076006.1) VersaClone cDNA

Sign In for Pricing
View Details
Ccdc67 Mouse shRNA Plasmid (Locus ID 234964)
TL516928 1 Kit

Ccdc67 Mouse shRNA Plasmid (Locus ID 234964)

Sign In for Pricing
View Details
Anti-GLUT3/SLC2A3 Antibody Picoband®
A03259-2 100 µg/Vial

Anti-GLUT3/SLC2A3 Antibody Picoband®

Sign In for Pricing
View Details