Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Asgr1. Target Synonyms: Hepatic lectin 1; HL-1; mHL-1. Accession Number: P34927. Expression Region: 61~284aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 52.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial is a purified Recombinant Protein.

Accession Number

P34927

Expression Region

61~284aa

Host

E. coli

Target

Asgr1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

52.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Hepatic lectin 1; HL-1; mHL-1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAG2 Rabbit Polyclonal Antibody (Cy5)
orb880641 100 µL

RAG2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
UBE2L3 Peptide
orb1234519 0.1 mg

UBE2L3 Peptide

Sign In for Pricing
View Details
DHH Rabbit Polyclonal Antibody (HRP)
orb480545 100 µL

DHH Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rat Cwf19l2 Pre-designed siRNA Set A
SI203429A 1 Each

Rat Cwf19l2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PGAP1 Protein Vector (Rat) (pPB-C-His)
PV293590 500 ng

PGAP1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Human ERVK3-1 Pre-designed siRNA Set B
SI005131B 1 Each

Human ERVK3-1 Pre-designed siRNA Set B

Sign In for Pricing
View Details