Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-1 (ARG1)

Recombinant Human Arginase-1 (ARG1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ARG1. Target Synonyms: Liver-type arginaseType I arginase. Accession Number: P05089. Expression Region: 1~322aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 61.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Arginase-1 (ARG1) is a purified Recombinant Protein.

Accession Number

P05089

Expression Region

1~322aa

Host

E. coli

Target

ARG1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

61.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Liver-type arginaseType I arginase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Galectin 8 (GAL8) ELISA
KBH2992 1x 96 Well

GENLISA™ Human Galectin 8 (GAL8) ELISA

Sign In for Pricing
View Details
IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (Biotin)
I3000-36-Biotin 100 µL

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (Biotin)

Sign In for Pricing
View Details
2x PCR Red Mix
TBS4004 2.0 mL

2x PCR Red Mix

Sign In for Pricing
View Details
Bovine Afadin (MLLT4) ELISA kit
GTR10430165 96 Well

Bovine Afadin (MLLT4) ELISA kit

Sign In for Pricing
View Details
OR2B6 Human shRNA Plasmid Kit (Locus ID 26212)
TL310919 1 Kit

OR2B6 Human shRNA Plasmid Kit (Locus ID 26212)

Sign In for Pricing
View Details
pExpress-1-Ndrg3 Plasmid
PVT45868 2 µg

pExpress-1-Ndrg3 Plasmid

Sign In for Pricing
View Details