Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-1 (ARG1)

Recombinant Human Arginase-1 (ARG1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ARG1. Target Synonyms: Liver-type arginaseType I arginase. Accession Number: P05089. Expression Region: 1~322aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 61.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Arginase-1 (ARG1) is a purified Recombinant Protein.

Accession Number

P05089

Expression Region

1~322aa

Host

E. coli

Target

ARG1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

61.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Liver-type arginaseType I arginase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR35 Antibody - C-terminal region (ARP64657_P050)
ARP64657_P050 100 µL

GPR35 Antibody - C-terminal region (ARP64657_P050)

Sign In for Pricing
View Details
STK36 shRNA (m) Lentiviral Particles
sc-153900-V 200 µL

STK36 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Pig Metaxin-2, MTX2 ELISA Kit
MBS9330859-01 48 Well

Pig Metaxin-2, MTX2 ELISA Kit

Sign In for Pricing
View Details
Pig Metaxin-2, MTX2 ELISA Kit
MBS9330859-02 96 Well

Pig Metaxin-2, MTX2 ELISA Kit

Sign In for Pricing
View Details
Pig Metaxin-2, MTX2 ELISA Kit
MBS9330859-03 5x 96 Well

Pig Metaxin-2, MTX2 ELISA Kit

Sign In for Pricing
View Details
Pig Metaxin-2, MTX2 ELISA Kit
MBS9330859-04 10x 96 Well

Pig Metaxin-2, MTX2 ELISA Kit

Sign In for Pricing
View Details