Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ADP-ribosylation factor 1 (ARF1)

Recombinant Human ADP-ribosylation factor 1 (ARF1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ARF1. Target Synonyms: ADP Ribosylation Factor 1; ADP-ribosylation factor 1; ARF 1; ARF1; ARF1_HUMAN. Accession Number: P84077. Expression Region: 2~181aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human ADP-ribosylation factor 1 (ARF1) is a purified Recombinant Protein.

Accession Number

P84077

Expression Region

2~181aa

Host

E. coli

Target

ARF1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ADP Ribosylation Factor 1; ADP-ribosylation factor 1; ARF 1; ARF1; ARF1_HUMAN

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PSMB8 (LMP7, PSMB5i, RING10, Y2, Proteasome Subunit beta Type-8, Low Molecular Mass Protein 7, Macropain Subunit C13, Multicatalytic Endopeptidase Complex Subunit C13, Proteasome Component C13, Proteasome Subunit beta-5i, Really Interesting New Gene 10 Pr
MBS6391135-01 0.1 mL

PSMB8 (LMP7, PSMB5i, RING10, Y2, Proteasome Subunit beta Type-8, Low Molecular Mass Protein 7, Macropain Subunit C13, Multicatalytic Endopeptidase Complex Subunit C13, Proteasome Component C13, Proteasome Subunit beta-5i, Really Interesting New Gene 10 Pr

Ask
View Details
PSMB8 (LMP7, PSMB5i, RING10, Y2, Proteasome Subunit beta Type-8, Low Molecular Mass Protein 7, Macropain Subunit C13, Multicatalytic Endopeptidase Complex Subunit C13, Proteasome Component C13, Proteasome Subunit beta-5i, Really Interesting New Gene 10 Pr
MBS6391135-02 5x 0.1 mL

PSMB8 (LMP7, PSMB5i, RING10, Y2, Proteasome Subunit beta Type-8, Low Molecular Mass Protein 7, Macropain Subunit C13, Multicatalytic Endopeptidase Complex Subunit C13, Proteasome Component C13, Proteasome Subunit beta-5i, Really Interesting New Gene 10 Pr

Ask
View Details
HIBADH Rabbit Polyclonal Antibody
TA337872 100 µL

HIBADH Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Pyruvate Dehydrogenase E1 beta Antibody
RC-15154-01 50 μL

Recombinant Pyruvate Dehydrogenase E1 beta Antibody

Ask
View Details
Recombinant Pyruvate Dehydrogenase E1 beta Antibody
RC-15154-02 100 µL

Recombinant Pyruvate Dehydrogenase E1 beta Antibody

Ask
View Details
Recombinant Pyruvate Dehydrogenase E1 beta Antibody
RC-15154-03 1 mL

Recombinant Pyruvate Dehydrogenase E1 beta Antibody

Ask
View Details