Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aquaporin-1 (AQP1), partial

Recombinant Human Aquaporin-1 (AQP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: AQP1. Target Synonyms: Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule. Accession Number: P29972. Expression Region: 220~269aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 32.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Aquaporin-1 (AQP1), partial is a purified Recombinant Protein.

Accession Number

P29972

Expression Region

220~269aa

Host

E. coli

Target

AQP1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Transport

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aquaporin-CHIPUrine water channelWater channel protein for red blood cells and kidney proximal tubule

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRM6, ID (GRM6, GPRC1F, MGLUR6, Metabotropic glutamate receptor 6) (MaxLight 405) discontinued
036315-ML405 100 µL

GRM6, ID (GRM6, GPRC1F, MGLUR6, Metabotropic glutamate receptor 6) (MaxLight 405) discontinued

Sign In for Pricing
View Details
mmu-miR-485 Primers
MPM00545 150 µL - 10 µM

mmu-miR-485 Primers

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)
MBS1352659-01 0.02 mg (E-Coli)

Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)
MBS1352659-02 0.02 mg (Yeast)

Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)
MBS1352659-03 0.1 mg (E-Coli)

Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)
MBS1352659-04 0.1 mg (Yeast)

Recombinant Burkholderia pseudomallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details