Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Annexin A4 (ANXA4)

Recombinant Human Annexin A4 (ANXA4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ANXA4. Target Synonyms: 35-beta calcimedinAnnexin IVAnnexin-4Carbohydrate-binding protein p33/p41Chromobindin-4Endonexin ILipocortin IVP32.5PP4-XPlacental anticoagulant protein II. Accession Number: P09525. Expression Region: 2~319aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Annexin A4 (ANXA4) is a purified Recombinant Protein.

Accession Number

P09525

Expression Region

2~319aa

Host

E. coli

Target

ANXA4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

35-beta calcimedinAnnexin IVAnnexin-4Carbohydrate-binding protein p33/p41Chromobindin-4Endonexin ILipocortin IVP32.5PP4-XPlacental anticoagulant protein II

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class II Antibody [2G11] (Biotin)
99-280 0.5 mg

MHC Class II Antibody [2G11] (Biotin)

Sign In for Pricing
View Details
Human Uteroglobin (SCGB1A1) ELISA Kit
abx252147-01 96 Tests

Human Uteroglobin (SCGB1A1) ELISA Kit

Sign In for Pricing
View Details
Human Uteroglobin (SCGB1A1) ELISA Kit
abx252147-02 5x 96 Tests

Human Uteroglobin (SCGB1A1) ELISA Kit

Sign In for Pricing
View Details
Human Uteroglobin (SCGB1A1) ELISA Kit
abx252147-03 10x 96 Tests

Human Uteroglobin (SCGB1A1) ELISA Kit

Sign In for Pricing
View Details
WAP CRISPR Activation Plasmid (m)
sc-423691-ACT 20 µg

WAP CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
DSCR3 (Down Syndrome Critical Region Protein 3, DSCR3 Arrestin Fold Containing)
479687 100 µL

DSCR3 (Down Syndrome Critical Region Protein 3, DSCR3 Arrestin Fold Containing)

Sign In for Pricing
View Details