Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Annexin A4 (ANXA4)

Recombinant Human Annexin A4 (ANXA4) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ANXA4. Target Synonyms: 35-beta calcimedinAnnexin IVAnnexin-4Carbohydrate-binding protein p33/p41Chromobindin-4Endonexin ILipocortin IVP32.5PP4-XPlacental anticoagulant protein II. Accession Number: P09525. Expression Region: 2~319aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Annexin A4 (ANXA4) is a purified Recombinant Protein.

Accession Number

P09525

Expression Region

2~319aa

Host

E. coli

Target

ANXA4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

35-beta calcimedinAnnexin IVAnnexin-4Carbohydrate-binding protein p33/p41Chromobindin-4Endonexin ILipocortin IVP32.5PP4-XPlacental anticoagulant protein II

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine PD-L1 Polyclonal Antibody
KP1917B-01 20 µg

Bovine PD-L1 Polyclonal Antibody

Sign In for Pricing
View Details
Bovine PD-L1 Polyclonal Antibody
KP1917B-02 100 µg

Bovine PD-L1 Polyclonal Antibody

Sign In for Pricing
View Details
CHCHD7 Antibody - C-terminal
OAPB01685-100UG 0.1 mg

CHCHD7 Antibody - C-terminal

Sign In for Pricing
View Details
MMP23B (Matrix Metallopeptidase 23B, MIFR, MIFR-1, MMP22) (APC)
248818-APC 100 µL

MMP23B (Matrix Metallopeptidase 23B, MIFR, MIFR-1, MMP22) (APC)

Sign In for Pricing
View Details
W/W016/NT-SA-PHOLUMB-TRI 150/1-B Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
836781 1 Pack (1 Panel (s) x 1 Pack)

W/W016/NT-SA-PHOLUMB-TRI 150/1-B Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
(3aR,4S,6R,6aS) -6-[7-[[ (1R,2S) -2- (3,4-Difluorophenyl) cyclopropyl]amino]-5- (propylthio) -3H-1,2,3-triazolo[4,5-d]pyrimidin-3-yl]tetrahydro-2,2-dimethyl-4H-cyclopenta-1,3-dioxol-4-ol
PC1001127 10 mg

(3aR,4S,6R,6aS) -6-[7-[[ (1R,2S) -2- (3,4-Difluorophenyl) cyclopropyl]amino]-5- (propylthio) -3H-1,2,3-triazolo[4,5-d]pyrimidin-3-yl]tetrahydro-2,2-dimethyl-4H-cyclopenta-1,3-dioxol-4-ol

Sign In for Pricing
View Details