Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Allograft inflammatory factor 1 (Aif1)

Recombinant Mouse Allograft inflammatory factor 1 (Aif1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Aif1. Target Synonyms: Ionized calcium-binding adapter molecule 1. Accession Number: O70200. Expression Region: 2~147aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Allograft inflammatory factor 1 (Aif1) is a purified Recombinant Protein.

Accession Number

O70200

Expression Region

2~147aa

Host

E. coli

Target

Aif1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ionized calcium-binding adapter molecule 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CGI-09 Antibody
NBP2-92578-0.1mL 0.1 mL

Rabbit Polyclonal CGI-09 Antibody

Sign In for Pricing
View Details
TERT Rabbit pAb, IRDye 800CW conjugated
orb3184325 100 µL

TERT Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Anti-IKK beta Antibody (9S545)
TMAB-07581-01 25 µL

Anti-IKK beta Antibody (9S545)

Sign In for Pricing
View Details
Anti-IKK beta Antibody (9S545)
TMAB-07581-02 50 μL

Anti-IKK beta Antibody (9S545)

Sign In for Pricing
View Details
Anti-IKK beta Antibody (9S545)
TMAB-07581-03 100 µL

Anti-IKK beta Antibody (9S545)

Sign In for Pricing
View Details
Cpne7 Rat shRNA Plasmid (Locus ID 361433)
TL706990 1 Kit

Cpne7 Rat shRNA Plasmid (Locus ID 361433)

Sign In for Pricing
View Details