Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Allograft inflammatory factor 1 (AIF1)

Recombinant Human Allograft inflammatory factor 1 (AIF1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: AIF1. Target Synonyms: Ionized calcium-binding adapter molecule 1; Protein G1. Accession Number: P55008. Expression Region: 2~147aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Allograft inflammatory factor 1 (AIF1) is a purified Recombinant Protein.

Accession Number

P55008

Expression Region

2~147aa

Host

E. coli

Target

AIF1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ionized calcium-binding adapter molecule 1; Protein G1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Tetrahydrofuran-2-ylacetic acid
OR480227 1 Each

2-Tetrahydrofuran-2-ylacetic acid

Sign In for Pricing
View Details
Phosphorodithioate mU (PS2) 5 umol scale
27-6630U-06 1 Each

Phosphorodithioate mU (PS2) 5 umol scale

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)
MBS1280012-01 0.02 mg (E-Coli)

Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)
MBS1280012-02 0.02 mg (Yeast)

Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)
MBS1280012-03 0.1 mg (E-Coli)

Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)

Sign In for Pricing
View Details
Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)
MBS1280012-04 0.1 mg (Yeast)

Recombinant Aspergillus oryzae Cytosolic Fe-S cluster assembly factor nbp35 (nbp35)

Sign In for Pricing
View Details