Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Agmatinase (speB)

Recombinant E. coli Agmatinase (speB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain 55989 / EAEC) . Target Name: speB. Target Synonyms: Agmatine ureohydrolaseAUH. Accession Number: B7LFJ6. Expression Region: 1~306aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Agmatinase (speB) is a purified Recombinant Protein.

Accession Number

B7LFJ6

Expression Region

1~306aa

Host

E. coli

Target

SpeB

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

49.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Agmatine ureohydrolaseAUH

Species

E. coli (strain 55989 / EAEC)

Protein Name

Recombinant Protein

AA Sequence

MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)
MBS1334327-01 0.02 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)
MBS1334327-02 0.02 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)
MBS1334327-03 0.1 mg (E-Coli)

Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)
MBS1334327-04 0.1 mg (Yeast)

Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)
MBS1334327-05 0.02 mg (Baculovirus)

Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)

Sign In for Pricing
View Details
Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)
MBS1334327-06 0.02 mg (Mammalian-Cell)

Recombinant Shigella dysenteriae serotype 1 Dihydrodipicolinate synthase (dapA)

Sign In for Pricing
View Details