Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin proteolipid protein (PLP1)

Recombinant Human Myelin proteolipid protein (PLP1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PLP1. Target Synonyms: LipophilinPLP. Accession Number: P60201. Expression Region: 2~277aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 35.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Myelin proteolipid protein (PLP1) is a purified CF Transmembrane Protein.

Accession Number

P60201

Expression Region

2~277aa

Host

E. coli

Target

PLP1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

LipophilinPLP

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GDF-15 Recombinant Rabbit monoclonal Antibody
HA723807B 100 µL

Human GDF-15 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human NEXMIF Knockout HEK293T cell line
GTR15410243 1 Vial

Human NEXMIF Knockout HEK293T cell line

Sign In for Pricing
View Details
Mouse mmu-miR-6989-5p miRNA Agomir
abx884034-01 5 nmol

Mouse mmu-miR-6989-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-6989-5p miRNA Agomir
abx884034-02 10 nmol

Mouse mmu-miR-6989-5p miRNA Agomir

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Catenin Beta Interacting Protein 1 (CTNNbIP1)
MBS2075716-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Catenin Beta Interacting Protein 1 (CTNNbIP1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Catenin Beta Interacting Protein 1 (CTNNbIP1)
MBS2075716-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Catenin Beta Interacting Protein 1 (CTNNbIP1)

Sign In for Pricing
View Details