Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adiponectin receptor protein 1 (ADIPOR1)

Recombinant Human Adiponectin receptor protein 1 (ADIPOR1) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ADIPOR1. Target Synonyms: Progestin and adipoQ receptor family member I. Accession Number: Q96A54. Expression Region: 1~375aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 62.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Adiponectin receptor protein 1 (ADIPOR1) is a purified CF Transmembrane Protein.

Accession Number

Q96A54

Expression Region

1~375aa

Host

E. coli

Target

ADIPOR1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

62.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Progestin and adipoQ receptor family member I

Species

Human (Homo sapiens)

Protein Name

CF Transmembrane Protein

AA Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)
MBS2037517-01 0.1 mL

FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)
MBS2037517-02 0.2 mL

FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)
MBS2037517-03 0.5 mL

FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)
MBS2037517-04 1 mL

FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)
MBS2037517-05 5 mL

FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)
MBS2037517-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Macrophage Derived Chemokine (MDC)

Sign In for Pricing
View Details