Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Odorant-binding protein

Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Bovine Odorant-binding protein. Target Synonyms: Olfactory mucosa pyrazine-binding protein. Accession Number: P07435. Expression Region: 1~159aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein.

Accession Number

P07435

Expression Region

1~159aa

Host

Baculovirus

Target

Bovine Odorant-binding protein

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Olfactory mucosa pyrazine-binding protein

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPPE (NM_001136238) Human Tagged Lenti ORF Clone
RC226759L3 10 µg

TMPPE (NM_001136238) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Thymidine Phosphorylase / PD-ECGF (Angiogenesis Marker) Antibody
orb1712081 0.5 mL

Thymidine Phosphorylase / PD-ECGF (Angiogenesis Marker) Antibody

Sign In for Pricing
View Details
PSMA7 Antibody Pair
MBS7041753-01 1 Pair (Sufficient for 5x96 well plates)

PSMA7 Antibody Pair

Sign In for Pricing
View Details
PSMA7 Antibody Pair
MBS7041753-02 5x 1 Pair (Sufficient for 25x 96 Well Plates)

PSMA7 Antibody Pair

Sign In for Pricing
View Details
DPRXP6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0629605 3x 1.0 µg

DPRXP6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RAD17 Antibody
MBS7120394-01 0.05 mg

RAD17 Antibody

Sign In for Pricing
View Details