Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Odorant-binding protein

Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: Bovine Odorant-binding protein. Target Synonyms: Olfactory mucosa pyrazine-binding protein. Accession Number: P07435. Expression Region: 1~159aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein.

Accession Number

P07435

Expression Region

1~159aa

Host

Baculovirus

Target

Bovine Odorant-binding protein

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Olfactory mucosa pyrazine-binding protein

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUSC3 (NM_006765) Human Tagged ORF Clone
RC215115 10 µg

TUSC3 (NM_006765) Human Tagged ORF Clone

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Desmoplakin (DSP)
MBS2149241-01 0.1 mL

PE-Linked Monoclonal Antibody to Desmoplakin (DSP)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Desmoplakin (DSP)
MBS2149241-02 0.2 mL

PE-Linked Monoclonal Antibody to Desmoplakin (DSP)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Desmoplakin (DSP)
MBS2149241-03 0.5 mL

PE-Linked Monoclonal Antibody to Desmoplakin (DSP)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Desmoplakin (DSP)
MBS2149241-04 1 mL

PE-Linked Monoclonal Antibody to Desmoplakin (DSP)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Desmoplakin (DSP)
MBS2149241-05 5 mL

PE-Linked Monoclonal Antibody to Desmoplakin (DSP)

Sign In for Pricing
View Details