Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis Alpha-crystallin (hspX)

Recombinant Mycobacterium bovis Alpha-crystallin (hspX) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) . Target Name: hspX. Target Synonyms: 16 kDa antigenHSP 16.3. Accession Number: P0A5B8. Expression Region: 2~144aa. Tag Info: C-Terminal 9Xhis-Tagged. Theoretical MW: 18.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mycobacterium bovis Alpha-crystallin (hspX) is a purified Recombinant Protein.

Accession Number

P0A5B8

Expression Region

2~144aa

Host

Baculovirus

Target

HspX

Conjugation

Unconjugated

Tag

C-Terminal 9Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

16 kDa antigenHSP 16.3

Species

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Protein Name

Recombinant Protein

AA Sequence

ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat flagellin ELISA Kit
GTR10437037 96 Well

Goat flagellin ELISA Kit

Sign In for Pricing
View Details
Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit
MBS8805157-01 48 Strip Well

Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit

Sign In for Pricing
View Details
Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit
MBS8805157-02 96 Strip Well

Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit

Sign In for Pricing
View Details
Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit
MBS8805157-03 5x 96 Strip Well

Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit

Sign In for Pricing
View Details
Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit
MBS8805157-04 10x 96 Strip Well

Human HTRA4 (High Temperature Requirement Factor A4) ELISA Kit

Sign In for Pricing
View Details
Anti-WIF1 Monoclonal Antibody
TMAZ-0142-01 25 µg

Anti-WIF1 Monoclonal Antibody

Sign In for Pricing
View Details